PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA22313
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NAC
Protein Properties Length: 288aa    MW: 32973.6 Da    PI: 9.2521
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA22313genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1501.1e-46711991128
                        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                                lppGfrF+Ptd+elv +yLk k+ + +l++ ++i+e++++k++Pw+Lp   +++e+++yfFs ++ ky++g+r nr+t+sgyWk
  Tp57577_TGAC_v2_mRNA22313  71 LPPGFRFQPTDQELVFQYLKCKTFSYQLPA-SIIPEINVCKYDPWELPG--NHGEQDMYFFSAKEAKYRNGNRMNRSTNSGYWK 151
                                79****************************.89***************4..457899*************************** PP

                        NAM  85 atgkdkevlsk....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                atg+dk+v ++    +g   g++k+Lvfy+ ++p+g++t+W+mheyrl
  Tp57577_TGAC_v2_mRNA22313 152 ATGSDKKVSVSssisNGGIAGIRKSLVFYNRKSPNGSRTHWIMHEYRL 199
                                ********99877777778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-5367227IPR003441NAC domain
PROSITE profilePS5100552.45571227IPR003441NAC domain
PfamPF023652.1E-2472199IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MFLIHIDILS VLLSHSHQSI YKYTHASTYV FGVAMLIHKP HINHFFEFKE KVLFKEMEKM  60
KFVKNGVSNK LPPGFRFQPT DQELVFQYLK CKTFSYQLPA SIIPEINVCK YDPWELPGNH  120
GEQDMYFFSA KEAKYRNGNR MNRSTNSGYW KATGSDKKVS VSSSISNGGI AGIRKSLVFY  180
NRKSPNGSRT HWIMHEYRLV SVETTACNQS FYEIDIGDWV LCRIFMKKRS NRMTLNTNVD  240
EAQPKFFDFM MAHKSSAPDP TTHFSSSSSC SSSGEVCSSG ERCSYID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-487123017168NO APICAL MERISTEM PROTEIN
1ut4_B8e-487123017168NO APICAL MERISTEM PROTEIN
1ut7_A8e-487123017168NO APICAL MERISTEM PROTEIN
1ut7_B8e-487123017168NO APICAL MERISTEM PROTEIN
3swm_A9e-487123020171NAC domain-containing protein 19
3swm_B9e-487123020171NAC domain-containing protein 19
3swm_C9e-487123020171NAC domain-containing protein 19
3swm_D9e-487123020171NAC domain-containing protein 19
3swp_A9e-487123020171NAC domain-containing protein 19
3swp_B9e-487123020171NAC domain-containing protein 19
3swp_C9e-487123020171NAC domain-containing protein 19
3swp_D9e-487123020171NAC domain-containing protein 19
4dul_A8e-487123017168NAC domain-containing protein 19
4dul_B8e-487123017168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602768.11e-105NAC transcription factor-like protein
SwissprotQ9FY936e-66NAC83_ARATH; NAC domain-containing protein 83
TrEMBLG7J3B81e-104G7J3B8_MEDTR; NAC transcription factor-like protein
STRINGGLYMA06G17480.17e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-60NAC domain containing protein 83